Vicilin-like Antimicrobial peptide 2a (MiAMP2a)

id PHYT00259
Name Vicilin-like Antimicrobial peptide 2a (MiAMP2a)
Gene AMP2-2
Family Vicilin-like family
Plant Macadamia integrifolia (Macadamia nut)
Taxonomy Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Proteales; Proteaceae; Macadamia;
Activity Antibacterial, Antifungal
Target organisms Gram-positive bacteria: (– Ca2+, + Ca2+) (IC50 ĩg/mL)
Clavibacter michiganensis(50, >50).
Fungi: (– Ca2+, + Ca2+) (IC50 ĩg/mL)
Alternaria helianthi (5–10, ND), Ceratocystis paradoxa (20–50, >50), Cercospora nicotianae (5–10, 5–10), Chalara elegans (2–5, 10–20), Fusarium oxysporum (10, 20–50), Leptosphaeria maculans (25, >50), Sclerotinia sclerotiorum (20–50, >50), Verticillium dahliae (5–10, >50), Saccharomyces cerevisiae (20–50, >50), Phytophthora cryptogea (5–10, 10–25), Phytophthora parasitica nicotianae (10–20, >50).
NOTE! – Ca2+ = Medium with low content of CaCl2 (50 ėM).
NOTE! + Ca2+ = Medium supplemented with high concentration of CaCl2 (1 mM).
Description Function:
Antimicrobial peptides 2b, 2c and 2d have antibacterial and antifungal activity against a range of species (By similarity).
Similarity:
Belongs to the 7S seed storage protein family.
Subcellular location:
Secreted (By similarity).
[1]
NUCLEOTIDE SEQUENCE [MRNA].
MEDLINE=20040040;PubMed=10571855;
Marcus J.P., Green J.L., Goulter K.C., Manners J.M.
"A family of antimicrobial peptides is produced by processing of a 7Sglobulin protein in Macadamia integrifolia kernels.", Plant J. 19:699-710(1999).


Formula C250 H383 N75 O92 S6
Absent amino acids AHP
Common amino acids E
Mass (Da) 6122.4
Net charge -6
Isoelectric point 4.17
Basic residues 8
Acidic residues 14
Hydrophobic residues 6
Polar residues 13
Aliphatic residues 3
Tiny residues 5
Boman Index -221.45
Hydropathy Index -1.71
Aliphatic Index 21.84
Instability Index 92.4 (unstable)
Half Life Mammalian : 1 hour
Yeast : 30 min
E. coli : >10 hour
Extinction Coefficient 8730 M-1 cm-1
Absorbance 280nm 181.88
Composition

Databases

PDB Structure:

Unknown

Other databases:

Sequence:

........10 ........20 ........30 
         |          |          | 
ESEFDRQEYEECKRQCMQLETSGQMRRCVS
QCDKRFEEDIDWSKYDNQD

Signal sequence:

........10 ........20 ........30 
         |          |          | 
MAINTSNLCSLLFLLSLFLLSTTVSLA

Method of sequencing:

Direct sequencing