Antifungal protein AX2

id PHYT00003
Name Antifungal protein AX2
Gene Unidentified
Family Defensin family
Plant Beta vulgaris (Sugar beet)
Taxonomy Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; Caryophyllales; Amaranthaceae; Beta;
Activity Antibacterial, Antifungal
Target organisms Fungi: Cercospora beticola and other filamentous fungi.
NOTE! Little or no effect against bacteria.
Description Function:
Strong inhibiting activity against C.beticola and other filamentous fungi. Little or no effect against bacteria.
Similarity:
Belongs to the plant defensin family.
Tissue specificity:
Leaves and flowers.
Mass spectrometry:
Mass=5193; Mass_error=3; Method=Electrospray; Range=1-46; Source=PubMed:7655063;
[1]
PROTEIN SEQUENCE, AND MASS SPECTROMETRY.
MEDLINE=95383713;PubMed=7655063;
Kragh K.M., Nielsen J.E., Nielsen K.K., Dreboldt S., Mikkelsen J.D.
"Characterization and localization of new antifungal cysteine-richproteins from Beta vulgaris.", Mol. Plant Microbe Interact. 8:424-434(1995).


Formula C216 H333 N65 O66 S9
Absent amino acids HI
Common amino acids C
Mass (Da) 5203.72
Net charge +3
Isoelectric point 8.2
Basic residues 7
Acidic residues 4
Hydrophobic residues 9
Polar residues 20
Aliphatic residues 2
Tiny residues 9
Boman Index -103.43
Hydropathy Index -0.63
Aliphatic Index 21.3
Instability Index 34.55 (stable)
Half Life Mammalian : 4.4 hour
Yeast : >20 hour
E. coli : >10 hour
Extinction Coefficient 7490 M-1 cm-1
Absorbance 280nm 166.44
Composition

Databases

Uniprot:

PDB Structure:

Unknown

Other databases:

HSSP P20158

Sequence:

........10 ........20 ........30 
         |          |          | 
ATCRKPSMYFSGACFSDTNCQKACNREDWP
NGKCLVGFKCECQRPC

Method of sequencing:

Direct sequencing